Reaction SMILES-AA mapping via language modelling

Related tags

Deep Learningrxnaamapper
Overview

rxn-aa-mapper

Reactions SMILES-AA sequence mapping

setup

conda env create -f conda.yml
conda activate rxn_aa_mapper

In the following we consider on examples provided to show how to use RXNAAMapper.

generate a vocabulary to be used with the EnzymaticReactionBertTokenizer

Create a vocabulary compatible with the enzymatic reaction tokenizer:

create-enzymatic-reaction-vocabulary ./examples/data-samples/biochemical ./examples/token_75K_min_600_max_750_500K.json /tmp/vocabulary.txt "*.csv"

use the tokenizer

Using the examples vocabulary and AA tokenizer provided, we can observe the enzymatic reaction tokenizer in action:

from rxn_aa_mapper.tokenization import EnzymaticReactionBertTokenizer

tokenizer = EnzymaticReactionBertTokenizer(
    vocabulary_file="./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    aa_sequence_tokenizer_filepath="./examples/token_75K_min_600_max_750_500K.json"
)
tokenizer.tokenize("NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]")

train the model

The mlm-trainer script can be used to train a model via MTL:

mlm-trainer \
    ./examples/data-samples/biochemical ./examples/data-samples/biochemical \  # just a sample, simply split data in a train and a validation folder
    ./examples/vocabulary_token_75K_min_600_max_750_500K.txt /tmp/mlm-trainer-log \
    ./examples/sample-config.json "*.csv" 1 \  # for a more realistic config see ./examples/config.json
    ./examples/data-samples/organic ./examples/data-samples/organic \  # just a sample, simply split data in a train and a validation folder
    ./examples/token_75K_min_600_max_750_500K.json

Checkpoints will be stored in the /tmp/mlm-trainer-log for later usage in identification of active sites.

Those can be turned into an HuggingFace model by simply running:

checkpoint-to-hf-model /path/to/model.ckpt /tmp/rxnaamapper-pretrained-model ./examples/vocabulary_token_75K_min_600_max_750_500K.txt ./examples/sample-config.json ./examples/token_75K_min_600_max_750_500K.json

predict active site

The trained model can used to map reactant atoms to AA sequence locations that potentially represent the active site.

from rxn_aa_mapper.aa_mapper import RXNAAMapper

config_mapper = {
    "vocabulary_file": "./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
    "aa_sequence_tokenizer_filepath": "./examples/token_75K_min_600_max_750_500K.json",
    "model_path": "/tmp/rxnaamapper-pretrained-model",
    "head": 3,
    "layers": [11],
    "top_k": 1,
}
mapper = RXNAAMapper(config=config_mapper)
mapper.get_reactant_aa_sequence_attention_guided_maps(["NC(=O)c1ccc[n+]([C@@H]2O[[email protected]](COP(=O)(O)OP(=O)(O)OC[[email protected]]3O[C@@H](n4cnc5c(N)ncnc54)[[email protected]](O)[C@@H]3O)[C@@H](O)[[email protected]]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]"])

citation

@article{dassi2021identification,
  title={Identification of Enzymatic Active Sites with Unsupervised Language Modeling},
  author={Dassi, Lo{\"\i}c Kwate and Manica, Matteo and Probst, Daniel and Schwaller, Philippe and Teukam, Yves Gaetan Nana and Laino, Teodoro},
  year={2021}
  conference={AI for Science: Mind the Gaps at NeurIPS 2021, ELLIS Machine Learning for Molecule Discovery Workshop 2021}
}
Owner
GitHub Repository
Code for SIMMC 2.0: A Task-oriented Dialog Dataset for Immersive Multimodal Conversations

The Second Situated Interactive MultiModal Conversations (SIMMC 2.0) Challenge 2021 Welcome to the Second Situated Interactive Multimodal Conversation

Facebook Research 81 Nov 22, 2022
COVID-VIT: Classification of Covid-19 from CT chest images based on vision transformer models

COVID-ViT COVID-VIT: Classification of Covid-19 from CT chest images based on vision transformer models This code is to response to te MIA-COV19 compe

17 Dec 30, 2022
Code for paper "ASAP-Net: Attention and Structure Aware Point Cloud Sequence Segmentation"

ASAP-Net This project implements ASAP-Net of paper ASAP-Net: Attention and Structure Aware Point Cloud Sequence Segmentation (BMVC2020). Overview We i

Hanwen Cao 26 Aug 25, 2022
Creating a custom CNN hypertunned architeture for the Fashion MNIST dataset with Python, Keras and Tensorflow.

custom-cnn-fashion-mnist Creating a custom CNN hypertunned architeture for the Fashion MNIST dataset with Python, Keras and Tensorflow. The following

Danielle Almeida 1 Mar 05, 2022
Short and long time series classification using convolutional neural networks

time-series-classification Short and long time series classification via convolutional neural networks In this project, we present a novel framework f

35 Oct 22, 2022
Physics-informed convolutional-recurrent neural networks for solving spatiotemporal PDEs

PhyCRNet Physics-informed convolutional-recurrent neural networks for solving spatiotemporal PDEs Paper link: [ArXiv] By: Pu Ren, Chengping Rao, Yang

Pu Ren 11 Aug 23, 2022
Causal Imitative Model for Autonomous Driving

Causal Imitative Model for Autonomous Driving Mohammad Reza Samsami, Mohammadhossein Bahari, Saber Salehkaleybar, Alexandre Alahi. arXiv 2021. [Projec

VITA lab at EPFL 8 Oct 04, 2022
FedML: A Research Library and Benchmark for Federated Machine Learning

FedML: A Research Library and Benchmark for Federated Machine Learning 📄 https://arxiv.org/abs/2007.13518 News 2021-02-01 (Award): #NeurIPS 2020# Fed

FedML-AI 2.3k Jan 08, 2023
This repository is the code of the paper Accelerating Deep Reinforcement Learning for Digital Twin Network Optimization with Evolutionary Strategies

ES_OTN_Public Carlos Güemes Palau, Paul Almasan, Pere Barlet Ros, Albert Cabellos Aparicio Contact us: Barcelona Neural Networking Center 8 Oct 11, 2022

Official implementation of "StyleCariGAN: Caricature Generation via StyleGAN Feature Map Modulation" (SIGGRAPH 2021)

StyleCariGAN in PyTorch Official implementation of StyleCariGAN:Caricature Generation via StyleGAN Feature Map Modulation in PyTorch Requirements PyTo

PeterZhouSZ 49 Oct 31, 2022
IRON Kaggle project done while doing IRONHACK Bootcamp where we had to analyze and use a Machine Learning Project to predict future sales

IRON Kaggle project done while doing IRONHACK Bootcamp where we had to analyze and use a Machine Learning Project to predict future sales. In this case, we ended up using XGBoost because it was the o

1 Jan 04, 2022
Python interface for the DIGIT tactile sensor

DIGIT-INTERFACE Python interface for the DIGIT tactile sensor. For updates and discussions please join the #DIGIT channel at the www.touch-sensing.org

Facebook Research 35 Dec 22, 2022
Creating Artificial Life with Reinforcement Learning

Although Evolutionary Algorithms have shown to result in interesting behavior, they focus on learning across generations whereas behavior could also be learned during ones lifetime.

Maarten Grootendorst 49 Dec 21, 2022
Run Effective Large Batch Contrastive Learning on Limited Memory GPU

Gradient Cache Gradient Cache is a simple technique for unlimitedly scaling contrastive learning batch far beyond GPU memory constraint. This means tr

Luyu Gao 198 Dec 29, 2022
A way to store images in YAML.

YAMLImg A way to store images in YAML. I made this after seeing Roadcrosser's JSON-G because it was too inspiring to ignore this opportunity. Installa

5 Mar 14, 2022
A PyTorch Implementation of "Neural Arithmetic Logic Units"

Neural Arithmetic Logic Units [WIP] This is a PyTorch implementation of Neural Arithmetic Logic Units by Andrew Trask, Felix Hill, Scott Reed, Jack Ra

Kevin Zakka 181 Nov 18, 2022
Image Restoration Using Swin Transformer for VapourSynth

SwinIR SwinIR function for VapourSynth, based on https://github.com/JingyunLiang/SwinIR. Dependencies NumPy PyTorch, preferably with CUDA. Note that t

Holy Wu 11 Jun 19, 2022
This repository focus on Image Captioning & Video Captioning & Seq-to-Seq Learning & NLP

Awesome-Visual-Captioning Table of Contents ACL-2021 CVPR-2021 AAAI-2021 ACMMM-2020 NeurIPS-2020 ECCV-2020 CVPR-2020 ACL-2020 AAAI-2020 ACL-2019 NeurI

Ziqi Zhang 362 Jan 03, 2023
[LREC] MMChat: Multi-Modal Chat Dataset on Social Media

MMChat This repo contains the code and data for the LREC2022 paper MMChat: Multi-Modal Chat Dataset on Social Media. Dataset MMChat is a large-scale d

Silver 47 Jan 03, 2023
This repository contains code for the paper "Disentangling Label Distribution for Long-tailed Visual Recognition", published at CVPR' 2021

Disentangling Label Distribution for Long-tailed Visual Recognition (CVPR 2021) Arxiv link Blog post This codebase is built on Causal Norm. Install co

Hyperconnect 85 Oct 18, 2022